Merge branch 'master' of https://git.wmi.amu.edu.pl/ahypki/bioinf-2023-2024-introduction-cpp

ex1-reading-fasta/description

@@ -6,12 +6,19 @@ https://en.wikipedia.org/wiki/FASTA_format
 
 The FASTA format with one sequence for an elephant looks like this:
 
->gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
-LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
-EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
-LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
-GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
-IENY
+>BTBSCRYR
+tgcaccaaacatgtctaaagctggaaccaaaattactttctttgaagacaaaaactttca
+aggccgccactatgacagcgattgcgactgtgcagatttccacatgtacctgagccgctg
+caactccatcagagtggaaggaggcacctgggctgtgtatgaaaggcccaattttgctgg
+gtacatgtacatcctaccccggggcgagtatcctgagtaccagcactggatgggcctcaa
+cgaccgcctcagctcctgcagggctgttcacctgtctagtggaggccagtataagcttca
+gatctttgagaaaggggattttaatggtcagatgcatgagaccacggaagactgcccttc
+catcatggagcagttccacatgcgggaggtccactcctgtaaggtgctggagggcgcctg
+gatcttctatgagctgcccaactaccgaggcaggcagtacctgctggacaagaaggagta
+ccggaagcccgtcgactggggtgcagcttccccagctgtccagtctttccgccgcattgt
+ggagtgatgatacagatgcggccaaacgctggctggccttgtcatccaaataagcattat
+aaataaaacaattggcatgc
+
 
 
 The FASTA format has to separate parts:
@@ -20,7 +27,7 @@ The FASTA format has to separate parts:
 2. sequence
 
 
-Thus, the excercise for reading FASTA file briefly looks like this:
+Thus, the excercise for reading FASTA file, in C, briefly looks like this:
 
 1. Select sequence and save it to a file, e.g. seq.fasta
 
@@ -28,4 +35,20 @@ Thus, the excercise for reading FASTA file briefly looks like this:
 
 https://cplusplus.com/reference/cstdio/fopen/
 
-Tip: Use correct mode.
+Tip: Use correct mode.
+
+3. Read the file, line by line, using e.g. snippet of code from here:
+
+https://cplusplus.com/forum/beginner/22558/
+
+4. Check if the lines starts with ';' or with '>', then skip such a line
+
+If the line is OK, then count how many A, C, T, G are in the given line and 
+save that information.
+
+In order to check if the line starts with a given character you can 
+simply use index of a string (line[0] - this is first character in the 
+array line).
+
+The end.
+